Image is an illustration, may not reflect the exact product sold.


Other products by Merck

Merck - 05-23-2005-0.5MG - Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

  • MFR SKU: 05-23-2005-0.5MG
  • ITEM #: 11577081
  • 0 Reviews / 0 Questions
$587.00
Stock Status: SHIPS SOON (reserve your unit today)
Average lead time for this brand: 2-3 weeks. Specific products may vary.

ITEM #: 11577081
A potent vasoconstrictor.
This listing is for .5 mg Glass bottle

Merck - 05-23-2005-0.5MG - Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem

  • Item #: 11577081
  • MFR SKU: 05-23-2005-0.5MG
  • Overview A potent vasoconstrictor. Reversibly inhibits Ca 2+ -activated K + channels in vascular smooth muscle cells.
  • Catalogue Number 05-23-2005
  • Brand Family Calbiochem®
  • Synonyms NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH
  • References Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280.
  • Wahlestedt, C., et al. 1993. Science 259, 528.
  • Leibowitz, S.F. 1992. NeuroReport 3, 1023.
  • CAS number 90880-35-6
  • ATP Competitive N
  • Form White to off-white lyophilized solid
  • Formulation Supplied as trifluoroacetate salt. Sold on the basis of peptide content.
  • Hill Formula CHNOS
  • Chemical formula CHNOS
  • Reversible Y
  • Sold on the basis of peptide content Y
  • Quality Level MQ100
  • Primary Target A potent vasoconstrictor
  • Purity ≥ 97% by HPLC
  • Cell permeable N
  • Peptide Content Y
  • Peptide Sequence H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH
  • R Phrase R: 20/21/22
  • Harmful by inhalation, in contact with skin and if swallowed.
  • S Phrase S: 36
  • Wear suitable protective clothing.
  • Ship Code Ambient Temperature Only
  • Toxicity Harmful
  • Storage -20° C
  • Protect from Moisture Protect from moisture
  • Do not freeze Ok to freeze
  • Special Instructions Following reconstitution, aliquot and freeze (-20° C). Stock solutions are stable for up to 3 months at -20° C.

There are no questions about this product yet. Be the first to ask a question.

0 out of 5 stars
5 Star
0 %
4 Star
0 %
3 Star
0 %
2 Star
0 %
1 Star
0 %

Review this product

Tell us about your personal experience

Recently Viewed Items