Image is an illustration, may not reflect the exact product sold.


Other products by Merck

Merck - 05-23-2151-0.5MG - PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

  • MFR SKU: 05-23-2151-0.5MG
  • ITEM #: 11577114
  • 0 Reviews / 0 Questions
$588.50
Stock Status: SHIPS SOON (reserve your unit today)
Average lead time for this brand: 2-3 weeks. Specific products may vary.

ITEM #: 11577114
Increases cAMP levels in a dose-dependent manner (EC = 4.7 nM).
This listing is for .5 mg Glass bottle

Merck - 05-23-2151-0.5MG - PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

  • Item #: 11577114
  • MFR SKU: 05-23-2151-0.5MG
  • Overview Increases cAMP levels in a dose-dependent manner (EC 50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
  • Catalogue Number 05-23-2151
  • Brand Family Calbiochem®
  • Synonyms Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH
  • References Kobayashi, H., et al. 1994. Brain Res. 647, 145.
  • Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
  • CAS number 127317-03-7
  • ATP Competitive N
  • Form White to off-white solid
  • Formulation Supplied as a trifluoroacetate salt.
  • Hill Formula CHNOS
  • Chemical formula CHNOS
  • Hygroscopic Hygroscopic
  • Reversible N
  • Sold on the basis of peptide content Y
  • Quality Level MQ100
  • Primary Target Increases cAMP levels 50 $anchor_PDP_OverviewTab_Product_Biological_Info_Primary Target IC 50 " value=" Biological Information"
  • br> Primary Target IC<sub> 50</sub> EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
  • Purity ≥ 97% by HPLC
  • Cell permeable N
  • Peptide Content Y
  • Peptide Sequence H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH
  • Ship Code Ambient Temperature Only
  • Toxicity Standard Handling
  • Storage -20° C
  • Hygroscopic Hygroscopic
  • Do not freeze Ok to freeze
  • Special Instructions Following reconstitution, aliquot and freeze (-20° C). Stock solutions are stable for up to 6 months at -20° C.

There are no questions about this product yet. Be the first to ask a question.

0 out of 5 stars
5 Star
0 %
4 Star
0 %
3 Star
0 %
2 Star
0 %
1 Star
0 %

Review this product

Tell us about your personal experience

Recently Viewed Items